Skip to main content
12 peptides are under FDA re-evaluation.
← All peptides
Immune SupportAwaiting Reclassification

Cathelicidin LL-37

The only human cathelicidin, fighting infection and rebuilding tissue at once

Injection, Topical · 503A Compounding

Educational content. This page describes Cathelicidin LL-37 for informational purposes only and is not medical advice, diagnosis, or treatment. Consult a licensed provider before starting, stopping, or modifying any therapy.

Researched and maintained by the PepHookup team. Regulatory status last verified July 25, 2026.

Primary Use
A 37-residue antimicrobial peptide from the human cathelicidin family.
Administration
injection, topical
Typical Cycle
Up to 4 weeks
Legal Status
Awaiting Reclassification
Find a Provider

Key Benefits

Accelerates Chronic Wound Healing

LL-37 is strongly expressed along the migrating keratinocyte edge of healing wounds and is nearly absent in chronic venous ulcer epithelium. In the only published human efficacy trial, topical LL-37 reduced ulcer area in stalled venous leg ulcers, supporting a real role in closing wounds that otherwise fail to progress.[1][2]

Drives Angiogenesis

LL-37 activates endothelial FPR2/ALX signaling to promote new vessel formation, an effect that has been demonstrated in cell and animal models including rabbit hindlimb ischemia. Rebuilding the vascular bed beneath a wound is part of why it supports repair rather than acting only as an antimicrobial.[5]

Modulates Innate Immunity

LL-37 chemotactically recruits neutrophils, monocytes, and T cells through formyl peptide receptor 2 (FPR2/ALX, also called FPRL1). It also binds and neutralizes bacterial LPS endotoxin, dampening the LPS-driven inflammatory cascade in macrophages rather than amplifying it.[6][7]

Broad-Spectrum Antimicrobial Defense

As the only human cathelicidin, LL-37 disrupts bacterial, fungal, and enveloped viral membranes through carpet and toroidal-pore mechanisms. Because the action is physical rather than aimed at a single molecular target, classical single-target antibiotic resistance pathways are less effective against it.[8]

Vitamin D Responsive Host Defense

The CAMP gene that encodes LL-37 is a direct transcriptional target of the vitamin D receptor, linking serum vitamin D to cathelicidin output in keratinocytes and myeloid cells. This connection underlies part of vitamin D's documented role in skin and respiratory antimicrobial immunity.[9][10]

What is Cathelicidin LL-37?

Cathelicidin LL-37 is a 37-amino-acid cationic, amphipathic alpha-helical host-defense peptide with the sequence [LL-37, 37 aa] and a molecular weight near 4.5 kDa. It is the mature, active C-terminal fragment of the 18 kDa precursor hCAP-18, which is encoded by the single human cathelicidin gene, CAMP. In neutrophils, the enzyme proteinase 3 cleaves hCAP-18 during degranulation to release LL-37, which folds into its bioactive helix on contact with membranes or anionic surfaces.

LL-37 is the only cathelicidin found in the human genome. It is produced by neutrophils, which hold its largest reservoir in secondary granules, and by keratinocytes, epithelial cells lining the respiratory, gastrointestinal, and genitourinary tracts, mast cells, monocytes, macrophages, and natural killer cells. Expression rises sharply with inflammation and wounding, and it is induced by 1,25-dihydroxyvitamin D3 acting through a vitamin D response element in the CAMP promoter. First characterized in the mid-1990s, LL-37 is now understood as an alarmin that bridges antimicrobial defense and tissue repair.

Despite being a natural human peptide, LL-37 has limited clinical development. Human evidence is essentially confined to topical use on chronic wounds in two small randomized trials. There is no approved drug product, and the same biology that makes it useful in wound healing makes it a documented autoantigen in psoriasis and lupus, which is central to how it should be evaluated.

How Does It Work?

LL-37's cationic amphipathic helix binds the anionic outer membrane of gram-positive and gram-negative bacteria, many fungi, and enveloped viruses. It first lies parallel to the bilayer in the carpet model, then at threshold concentrations organizes into transient toroidal pores that collapse the membrane potential and lyse the cell. Because the mechanism is physical, bacteria adapt mainly by altering outer-surface charge rather than by the target mutations that defeat conventional antibiotics.

Beyond killing pathogens, LL-37 is chemotactic for neutrophils, monocytes, mast cells, and T cells through the G-protein-coupled receptor FPR2/ALX. It binds and neutralizes bacterial LPS, and in macrophages it has been shown to inhibit LPS- and ATP-driven inflammatory pyroptosis, blunting a sepsis-like inflammatory response. At lower concentrations it shapes dendritic cell differentiation and tunes cytokine output. This combination of direct killing and immune signaling is why it is classified as an alarmin rather than a simple antibiotic.

In skin, LL-37 is upregulated at the migrating edge of re-epithelializing wounds yet is nearly absent from the edges of chronic venous ulcers. Blocking endogenous LL-37 with neutralizing antibodies arrests re-epithelialization in ex vivo human wound cultures, which suggests its deficiency is part of the failure to heal rather than a bystander finding. LL-37 drives keratinocyte migration by transactivating the EGF receptor and signals through FPR2/ALX, while inducing endothelial proliferation and new vessel formation in cell and animal models.

An honest counterpoint runs through the same biology. When LL-37 binds self-DNA or self-RNA released from dying cells, it forms complexes that activate plasmacytoid dendritic cells and drive type-I interferon. This makes it a documented autoantigen in psoriasis, including a direct T-cell target, and a driver of self-DNA-peptide complexes in systemic lupus. Its cancer behavior is context-dependent, with pro-tumor signals reported in melanoma and ovarian models and tumor-suppressing or pro-apoptotic effects reported in gastric and colon cancer cells.

Mechanism of Action

LL-37 disrupts pathogen membranes, recruits immune cells through FPR2/ALX, neutralizes LPS endotoxin, and drives keratinocyte migration and angiogenesis. A single endogenous peptide that fights infection and rebuilds tissue in parallel, with the same biology underlying its autoimmune cautions.

LL-37Membrane DisruptionCarpet / toroidal poreFPR2/ALX SignalingChemotaxis & resolutionEGFR TransactivationHB-EGF sheddingLPS NeutralizationBlunts TLR4 cascadeVitamin D / VDR AxisCAMP gene inductionPathogen ClearanceBacteria, fungi, virusesLow resistance profileRe-EpithelializationKeratinocyte migrationWound closureAngiogenesisEndothelial proliferationVEGF-like neovesselsImmune RecruitmentNeutrophils & monocytesCytokine tuningBarrier RestorationKeratinocyte defenseReduced reinfectionSimultaneous Antimicrobial & Regenerative Response

Clinical Evidence

Endogenous LL-37 in Re-Epithelialization (Heilborn 2003)

Ex vivo and in vivo histology and function study of acute and chronic human skin woundsBiopsies from healing acute wounds and from chronic venous ulcers

LL-37 protein was strongly expressed along migrating keratinocyte tongues in acute healing wounds but was absent or markedly reduced at chronic ulcer edges. Blocking LL-37 with neutralizing antibodies inhibited re-epithelialization in ex vivo wound cultures, establishing LL-37 deficiency as a feature of non-healing wounds rather than a correlate.

Heilborn JD, Nilsson MF, Kratz G, et al. · J Invest Dermatol, 120(3):379-389 (2003) · PubMed

Topical LL-37 for Hard-to-Heal Venous Leg Ulcers (Gronberg 2014)

Multicenter, randomized, double-blind, placebo-controlled Phase I/IIa trial with a 3-week open-label placebo run-in, 4 weeks of randomized treatment, and 4 weeks of follow-up34 adults with chronic venous leg ulcers stalled for at least 6 months

The 1.6 mg/mL arm reduced mean ulcer area by roughly half and showed a healing rate constant about three times placebo, with a significant reduction from baseline on square-root-transformed wound area (p = 0.011). The 0.5 and 3.2 mg/mL doses were less effective, an inverted-U dose response. No safety concerns were identified. This is the pivotal published human efficacy trial.

Gronberg A, Mahlapuu M, Stahle M, Whately-Smith C, Rollman O · Wound Repair Regen, 22(5):613-621 (2014) · PubMed

Multicentric VLU Confirmation Trial (Mahlapuu 2021)

Multicentric prospective randomized placebo-controlled clinical trialAdults with hard-to-heal venous leg ulcers

A larger follow-up trial of topical LL-37 in venous leg ulcers. The peptide was well tolerated, but the efficacy signal seen in the earlier Phase I/IIa study did not reach the same level of statistical significance in this cohort, underscoring that human efficacy evidence remains limited and not yet definitive.

Mahlapuu M, Bjorn C, Ekblom J · Wound Repair Regen, 29(6):938-950 (2021) · PubMed

LL-37 as a T-Cell Autoantigen in Psoriasis (Lande 2014)

Mechanistic and immunological study in patients with psoriasisBlood and skin from psoriasis patients and controls

Circulating LL-37-specific T cells were detected in a majority of patients with moderate-to-severe plaque psoriasis and correlated with disease activity. LL-37 acted as a genuine T-cell autoantigen driving both interferon-gamma and Th17 responses, building on the earlier finding that LL-37 bound to self-DNA activates plasmacytoid dendritic cells. This establishes a concrete prescribing caution rather than a theoretical one.

Lande R, Botti E, Jandus C, et al. · Nat Commun, 5:5621 (2014) · PubMed

Context-Dependent Cancer Biology (Coffelt 2009; Wu 2010)

Cell-line and animal tumor modelsOvarian and gastric cancer cell and xenograft models

In ovarian cancer, LL-37 promoted tumor progression by recruiting mesenchymal stromal cells through FPR2/ALX. In gastric cancer cells, by contrast, LL-37 activated tumor-suppressing bone morphogenetic protein signaling and inhibited proliferation. These opposing findings show the cancer effect is tissue-specific, which is why patients with active or recent malignancy warrant caution.

Coffelt SB, Marini FC, Watson K, et al. · Proc Natl Acad Sci U S A, 106(10):3806-3811 (2009) · PubMed

Dosing & Administration

Topical (evidence-based)

Dosage
1.6 mg/mL in sterile saline
Frequency
Twice weekly application to the wound bed
Cycle
Up to 4 weeks

Subcutaneous / systemic (NOT established)

Dosage
Not established
Frequency
Not established
Cycle
Not established

Topical (evidence-based): Follows the Gronberg 2014 Phase I/IIa venous leg ulcer protocol under standard compression and moist-wound-care dressings. The 1.6 mg/mL concentration showed the strongest signal; 0.5 mg/mL appeared under-dosed and 3.2 mg/mL did not outperform 1.6 mg/mL. Actual dosing is determined by a licensed provider.

Subcutaneous / systemic (NOT established): No published Phase I human safety trials of subcutaneous or injectable LL-37 exist. Any systemic protocol circulating in wellness or compounding literature is unvalidated, lacks human pharmacokinetic data, and should be treated as research-only.

Dosing is determined by a licensed provider based on the specific condition and treatment goals. Human efficacy evidence is limited to topical use on chronic wound beds, and extrapolation to systemic dosing is not supported by published human data.

The topical dose response is non-monotonic, following an inverted-U. Higher concentrations did not produce better healing in the Gronberg trial, consistent with cytotoxicity thresholds becoming relevant at the wound surface.

LL-37 is a peptide and is therefore heat- and protease-sensitive. It requires sterile compounding, refrigerated storage, and use within a short window after reconstitution.

The FDA has cited immunogenicity and aggregation as specific concerns for LL-37 as a compounded bulk substance, which is directly relevant to the safety profile of any injectable formulation.

Side Effects & Safety

Common

  • Local irritation or stinging at topical sites: Transient with saline-based formulations in the Gronberg trial

Uncommon

  • Erythema around the wound edge: Generally self-limited
  • Mast cell activation and histamine release: LL-37 is a known mast-cell chemoattractant. Anecdotal reports of flushing or hives in sensitive patients.
  • Flare of underlying inflammatory skin disease: Mechanistically plausible given LL-37's role as a psoriasis autoantigen. Patients with psoriasis or eczema warrant close monitoring.

Rare

  • Hemolysis at supratherapeutic concentrations: Reported in vitro at high micromolar exposures outside therapeutic ranges. Not expected at compounded topical dosing.
  • Cytokine-driven malaise: Possible at higher exposures given LL-37's chemokine-like activity. Not systematically characterized in humans.
  • Injection-site reactions (if used subcutaneously off-label): Frequency unknown. No published Phase I safety data exist for subcutaneous LL-37.

Safety Profile

LL-37 complexed with self-DNA or self-RNA activates plasmacytoid dendritic cells and drives type-I interferon. It is a documented T-cell autoantigen in psoriasis and a driver of self-DNA-peptide complexes in systemic lupus, where it is also associated with neutrophil extracellular traps and inflammasome activation. This is an established prescribing consideration, not a theoretical one.

Published human exposure is essentially limited to topical application on wounds in two small randomized trials. There is no Phase III data, no long-term safety data, and no published Phase I systemic pharmacokinetic or tolerability study.

Cancer biology is context-dependent. Pro-tumor signals in cutaneous melanoma and ovarian models contrast with tumor-suppressing and pro-apoptotic effects reported in gastric and colon cancer cells. The literature is mixed, so patients with active or recent malignancy warrant a cautious approach.

The FDA placed LL-37 in 503A Category 2 citing immunogenicity and aggregation concerns. Category 2 means enforcement risk rather than prohibition, so most compounding pharmacies decline to prepare it and many physicians are hesitant to prescribe it while its regulatory status is unsettled.

Contraindications

  • Active or historical psoriasis, since LL-37 is a documented psoriasis autoantigen
  • Systemic lupus erythematosus or other interferon-driven autoimmune disease
  • Active melanoma or ovarian malignancy given reported pro-tumor signaling
  • Active autoimmune skin flare, including cutaneous and discoid lupus
  • Pregnancy and lactation, due to insufficient human data

Compare with Similar Peptides

PeptidePrimary UseAdministrationCycle LengthKey Differentiator
Cathelicidin LL-37Chronic Wound Healing & AntimicrobialTopical4 weeks (twice weekly application)The only human cathelicidin. A single endogenous peptide that combines wound-healing, angiogenic, and broad-spectrum antimicrobial activity through overlapping FPR2/ALX and EGFR pathways, balanced against documented autoimmune cautions.
GHK-CuAnti-Aging & Skin RegenerationTopical, Injection8-12 weeksA naturally occurring copper-carrier peptide that rebuilds the skin matrix and, per gene-expression analysis, shifts expression of about a third of human genes toward repair
GlutathioneAntioxidant & DetoxificationIV, Oral, Sublingual, TopicalOngoing supplementationThe body's own master antioxidant, with controlled human data showing oral and sublingual forms can raise body stores and immune markers
BPC-157Recovery & HealingInjection, Oral4–8 weeksUnusually stable in gastric acid; broad multi-system healing signal, though evidence is largely preclinical
Thymosin Alpha-1Immune SupportInjection6-12 months (chronic) / short courses (acute)Bidirectional immunomodulation that can strengthen suppressed immunity while helping temper hyperinflammation; approved as a pharmaceutical in 35+ countries

Regulatory Status

Under Review (Category 2)

503A Compounding

The FDA placed this substance in Category 2 of the 503A bulk drug substances evaluation, flagging significant safety risks. 503A compounding carries FDA enforcement risk, so most pharmacies decline to prepare it and many physicians hesitate to prescribe it.

PCAC review scheduled

In April 2026, HHS Secretary Robert F. Kennedy Jr. announced that nominators withdrew 12 peptides from Category 2 of the FDA's 503A bulk drug substances evaluation, including this one, and the FDA referred them to its Pharmacy Compounding Advisory Committee (PCAC) for re-evaluation. This one was not heard at the July 2026 meeting. It is on the agenda for the follow-up PCAC meeting scheduled for February 2027. Until that review runs and the FDA acts on it, this substance stays in Category 2.

FDA PCAC meeting schedule

Regulatory Detail

Endogenous antimicrobial peptide studied for antimicrobial, wound-healing, and anti-inflammatory applications. Listed in Category 2 with FDA-cited immunogenicity and aggregation concerns. Named by HHS in April 2026 among 12 peptides withdrawn from Category 2 for PCAC re-evaluation. Not heard at the July 2026 meeting; scheduled for the follow-up meeting before the end of February 2027.

Next Expected Action

PCAC review. Expected by the end of February 2027.

Source

FDA Action History

What do these terms mean?
503A compounding
Licensed pharmacies that prepare custom prescriptions for individual patients based on a physician's order. 503A is the section of the federal law that governs them.
503B outsourcing
FDA-registered facilities that compound in larger batches under stricter federal oversight (closer to a manufacturer than a pharmacy). Used mostly by hospitals and clinics.
Bulk drug substance
The active pharmaceutical ingredient a compounder starts with, before it's made into a finished medication.
Category 1
Interim bucket for bulk substances that have been nominated and don't appear to present significant safety risks. 503A pharmacies may compound them under FDA enforcement discretion while the agency continues its review. Not the same as FDA approval.
Category 2
Bulk substances the FDA has flagged for significant safety risks. 503A compounding carries FDA enforcement risk, so most pharmacies decline to prepare them and many physicians hesitate to prescribe them.
PCAC
Pharmacy Compounding Advisory Committee. The FDA advisory committee that reviews nominated bulk substances and recommends whether they belong in Category 1, Category 2, or on the final 503A Bulks List.

Last verified July 25, 2026. PepHookup tracks public FDA actions. This is not legal or medical advice.

Frequently Asked Questions

Research & References

  1. 1

    Heilborn JD, Nilsson MF, Kratz G, et al. The cathelicidin anti-microbial peptide LL-37 is involved in re-epithelialization of human skin wounds and is lacking in chronic ulcer epithelium.” J Invest Dermatol, 120(3):379-389 (2003)

  2. 2

    Gronberg A, Mahlapuu M, Stahle M, Whately-Smith C, Rollman O Treatment with LL-37 is safe and effective in enhancing healing of hard-to-heal venous leg ulcers: a randomized, placebo-controlled clinical trial.” Wound Repair Regen, 22(5):613-621 (2014)

  3. 3

    Mahlapuu M, Bjorn C, Ekblom J Evaluation of LL-37 in healing of hard-to-heal venous leg ulcers: a multicentric prospective randomized placebo-controlled clinical trial.” Wound Repair Regen, 29(6):938-950 (2021)

  4. 4

    Tokumaru S, Sayama K, Shirakata Y, et al. Induction of keratinocyte migration via transactivation of the epidermal growth factor receptor by the antimicrobial peptide LL-37.” J Immunol, 175(7):4662-4668 (2005)

  5. 5

    Koczulla R, von Degenfeld G, Kupatt C, et al. An angiogenic role for the human peptide antibiotic LL-37/hCAP-18.” J Clin Invest, 111(11):1665-1672 (2003)

  6. 6

    Yang D, Chen Q, Schmidt AP, et al. LL-37, the neutrophil granule- and epithelial cell-derived cathelicidin, utilizes formyl peptide receptor-like 1 (FPRL1) as a receptor to chemoattract human peripheral blood neutrophils, monocytes, and T cells.” J Exp Med, 192(7):1069-1074 (2000)

  7. 7

    Hu Z, Murakami T, Suzuki K, et al. Antimicrobial cathelicidin peptide LL-37 inhibits the LPS/ATP-induced pyroptosis of macrophages by dual mechanism.” PLoS One, 9(1):e85765 (2014)

  8. 8

    Durr UHN, Sudheendra US, Ramamoorthy A LL-37, the only human member of the cathelicidin family of antimicrobial peptides.” Biochim Biophys Acta (Biomembranes), 1758(9):1408-1425 (2006)

  9. 9

    Gombart AF, Borregaard N, Koeffler HP Human cathelicidin antimicrobial peptide (CAMP) gene is a direct target of the vitamin D receptor and is strongly up-regulated in myeloid cells by 1,25-dihydroxyvitamin D3.” FASEB J, 19(9):1067-1077 (2005)

  10. 10

    Liu PT, Stenger S, Li H, et al. Toll-like receptor triggering of a vitamin D-mediated human antimicrobial response.” Science, 311(5768):1770-1773 (2006)

  11. 11

    Lande R, Botti E, Jandus C, et al. The antimicrobial peptide LL37 is a T-cell autoantigen in psoriasis.” Nat Commun, 5:5621 (2014)

  12. 12

    Lande R, Gregorio J, Facchinetti V, et al. Plasmacytoid dendritic cells sense self-DNA coupled with antimicrobial peptide.” Nature, 449(7162):564-569 (2007)

  13. 13

    Lande R, Ganguly D, Facchinetti V, et al. Neutrophils activate plasmacytoid dendritic cells by releasing self-DNA-peptide complexes in systemic lupus erythematosus.” Sci Transl Med, 3(73):73ra19 (2011)

  14. 14

    Coffelt SB, Marini FC, Watson K, et al. The pro-inflammatory peptide LL-37 promotes ovarian tumor progression through recruitment of multipotent mesenchymal stromal cells.” Proc Natl Acad Sci U S A, 106(10):3806-3811 (2009)

  15. 15

    Wu WK, Sung JJ, To KF, et al. The host defense peptide LL-37 activates the tumor-suppressing bone morphogenetic protein signaling via inhibition of proteasome in gastric cancer cells.” J Cell Physiol, 223(1):178-186 (2010)

  16. 16

    Kim JE, Kim HJ, Choi JM, et al. The antimicrobial peptide human cationic antimicrobial protein-18/cathelicidin LL-37 as a putative growth factor for malignant melanoma.” Br J Dermatol, 163(5):959-967 (2010)

Ready to explore Cathelicidin LL-37 therapy?

Looking into Cathelicidin LL-37? Find a provider who knows this peptide and can walk you through your options.

Find a Provider